PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G148772_P01
Common NameLOC103626702, Zm.85703
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family CO-like
Protein Properties Length: 373aa    MW: 38834.5 Da    PI: 6.4976
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G148772_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box162.5e-051453440
           zf-B_box  4 rkCpeHeekelqlfCedC..qqllCedClleeHkg..Htvv 40
                       r+C  ++  ++  +C++C  + +lC  C    H +  H++v
  GRMZM2G148772_P01 14 RRCGACGGSPAAAHCRTCpgGAYLCGGCDAG-HARagHERV 53
                       79****************7778********9.977889875 PP

2zf-B_box20.69.5e-075398342
           zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                        ++C+ +e  ++   C+ +   lC+ C   +H        H++vp+
  GRMZM2G148772_P01 53 VWVCEVCECAPAAVTCRADAAALCAACDADIHDAnplarrHERVPV 98
                       689*****************************44788888999986 PP

3CCT70.54.2e-24283326144
                CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                        Rea+l+RY+eKrk+R+FeK+irY+sRKa+AesRpR+KGrF+k+a
  GRMZM2G148772_P01 283 REARLMRYREKRKNRRFEKTIRYASRKAYAESRPRIKGRFAKRA 326
                        9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.0391155IPR000315B-box-type zinc finger
PROSITE profilePS5011910.6235198IPR000315B-box-type zinc finger
PfamPF006431.2E-55298IPR000315B-box-type zinc finger
SMARTSM003369.5E-75698IPR000315B-box-type zinc finger
PROSITE profilePS5101716.926283325IPR010402CCT domain
PfamPF062038.8E-18283325IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MEALVGRYWG LGGRRCGACG GSPAAAHCRT CPGGAYLCGG CDAGHARAGH ERVWVCEVCE  60
CAPAAVTCRA DAAALCAACD ADIHDANPLA RRHERVPVQP IGAAADPAAE KAALLFGLAA  120
EGKDGGDAAK VVVDASKLDL LFADDVVDPF LAQDFARFPH ADSVVPNDGS NCGAAVDFDF  180
GGGVAVAAKQ PSYSSYTAAS LGHSGSSSEV GLVPDVMCGR GGSVTGGVIE LDFAQSKAAY  240
LPYAATPTHS LSSLDVGAVP ERSDGVMAGR LATPTPATAT ESREARLMRY REKRKNRRFE  300
KTIRYASRKA YAESRPRIKG RFAKRADDND ADADLDEAAA PAPPARSQPQ PQPQPSYRYV  360
LDFAAGYGVV PTF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.857031e-140shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G148772
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G148772_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1210245e-33AK121024.1 Oryza sativa Japonica Group cDNA clone:J023049O11, full insert sequence.
GenBankAL6066275e-33AL606627.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0067K08, complete sequence.
GenBankAP0149605e-33AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126125e-33CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankCR8552095e-33CR855209.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0092E01, complete sequence.
GenBankEU9562395e-33EU956239.1 Zea mays clone 1559496 CONSTANS-like protein CO5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008645312.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 3-like
TrEMBLA0A096SH800.0A0A096SH80_MAIZE; Uncharacterized protein
STRINGGRMZM2G148772_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.13e-33CONSTANS-like 5